Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d019721_circ_g.1 |
ID in PlantcircBase | zma_circ_009274 |
Alias | zma_circ_0002728, GRMZM2G064594_C1 |
Organism | Zea mays |
Position | chr7: 53771916-53772523 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d019721 |
Parent gene annotation |
Triacylglycerol lipase 1 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d019721_T003:3 Zm00001d019721_T001:4 Zm00001d019721_T002:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.171961655 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
53772474-53772491(-) |
Potential amino acid sequence |
MLSYVYTVAQSKILYVGHSQGTIMGLAAFTMPETVKMISSAALLCPISYLDHVSASFVLRAVAM HLDEMLVIMGIHQLNFRSDMGVQILDSLCDDEHLDCNDLLSSITAFLGLELARPC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |