Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.004G024500_circ_g.1 |
| ID in PlantcircBase | gra_circ_000313 |
| Alias | Chr04:1877706|1879247 |
| Organism | Gossypium raimondii |
| Position | chrChr04: 1877706-1879247 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.004G024500 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.004G024500.3:3 Gorai.004G024500.4:3 Gorai.004G024500.8:3 Gorai.004G024500.9:3 Gorai.004G024500.7:3 Gorai.004G024500.2:3 Gorai.004G024500.5:3 Gorai.004G024500.6:3 Gorai.004G024500.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.113140208 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1878332-1879236(-) 1879195-1877760(+) |
| Potential amino acid sequence |
MVEDDISSRAGNLTLTNLGAEAISDVTSSSGPVKLEDLQRILSSIGPAGAES*(-) MKLLTAQHNCESSSAFGSCWTNTAQYSLQVFQFNWP*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |