Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0208600_circ_g.5 |
ID in PlantcircBase | osa_circ_013766 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 6087559-6088147 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0208600 |
Parent gene annotation |
Transcription elongation factor S-II, central region domain cont aining protein. (Os02t0208600-01) |
Parent gene strand | + |
Alternative splicing | Os02g0208600_circ_g.1 Os02g0208600_circ_g.2 Os02g0208600_circ_g.3 Os02g0208600_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0208600-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.14601129 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6087678-6087561(+) 6088120-6087561(+) 6088140-6087674(-) |
Potential amino acid sequence |
MVTELCWKEGSHESGRQHLLQW*(+) MRVVANISCSGEKPPVKEWRSFVEIKGRVKLSAFQEFVEQLPKSRSRAIMVTELCWKEGSHESG RQHLLQW*(+) MLATTLMRTFLPTQLSYHYSTAPRFGKLFNKLLKGTKFDSPLDFNKAPPFFYWWLFTTARDVGD HSHENLPSNTTQLPL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |