Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G15750_circ_g.9 |
| ID in PlantcircBase | ath_circ_002799 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 5417207-5417347 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G15750 |
| Parent gene annotation |
Protein TOPLESS |
| Parent gene strand | - |
| Alternative splicing | AT1G15750_circ_g.1 AT1G15750_circ_g.2 AT1G15750_circ_g.3 AT1G15750_circ_g.4 AT1G15750_circ_g.5 AT1G15750_circ_g.6 AT1G15750_circ_g.7 AT1G15750_circ_g.8 AT1G15750_circ_g.10 AT1G15750_circ_g.11 AT1G15750_circ_g.12 AT1G15750_circ_g.13 AT1G15750_circ_g.14 AT1G15750_circ_g.15 AT1G15750_circ_g.16 |
| Support reads | 21 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G15750.1:1 AT1G15750.4:1 AT1G15750.3:1 AT1G15750.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.253796718 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5417273-5417209(-) 5417226-5417344(+) |
| Potential amino acid sequence |
MANSDGLRLLHTFENISSESSKASPRIRFNKEGSLLAVSGNENVIKIMANSDGLRLLHTFENIS SESSKASPRIRFNKEGSLLAVSGNENVIKIMANSDGLRLLHTFENISSESSKASPRIRFNKEGS LLAVSGNENVIKIMANSDGLRLLHTFENISSESSK(-) MFSKVCNSLRPSEFAIILITFSLPDTARREPSLLNRIRGLALEDSDDMFSKVCNSLRPSEFAII LITFSLPDTARREPSLLNRIRGLALEDSDDMFSKVCNSLRPSEFAIILITFSLPDTARREPSLL NRIRGLALEDSDDMFSKVCNSLRPSEFAIILITFSLPDTARREPSLLNRIRGL(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |