Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0102900_circ_g.6 |
| ID in PlantcircBase | osa_circ_012630 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 162156-162449 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os02g0102950 |
| Parent gene annotation |
Hypothetical protein. (Os02t0102950-00) |
| Parent gene strand | - |
| Alternative splicing | Os02g0102900_circ_g.5 Os02g0102900_circ_g.7 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0102900-01:2 Os02t0102900-01:2 Os02t0102950-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.41684572 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
162420-162158(-) |
| Potential amino acid sequence |
MASTFDASRKSVQPPPTTIPSSTAALVAFSASSTLSFFSLSSVSVCAPTFCSSFSSVSIMASTF DASRKSVQPPPTTIPSSTAALVAFSASSTLSFFSLSSVSVCAPTFCSSFSSVSIMASTFDASRK SVQPPPTTIPSSTAALVAFSASSTLSFFSLSSVSVCAPTFCSSFSSVSIMASTFDASRKSVQPP PTTIPSSTAALVAFSASSTLSFFSLSSVSVCAP(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |