Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G77080_circ_g.4 |
| ID in PlantcircBase | ath_circ_010577 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 28958602-28959371 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | AT1G77080 |
| Parent gene annotation |
K-box region and MADS-box transcription factor family protein |
| Parent gene strand | + |
| Alternative splicing | AT1G77080_circ_g.1 AT1G77080_circ_g.2 AT1G77080_circ_g.3 AT1G77080_circ_g.5 AT1G77080_circ_g.6 |
| Support reads | 2 |
| Tissues | root, inflorescences |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G77080.10:4 AT1G77080.6:3 AT1G77080.2:4 AT1G77080.8:3 AT1G77080.5:4 AT1G77080.3:2 AT1G77080.7:4 AT1G77080.12:4 AT1G77080.9:3 AT1G77080.4:4 AT1G77080.11:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.149162521 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28958962-28959368(+) |
| Potential amino acid sequence |
MMEYIESLKEKEKLLREENQVLASQDLEEKIQNYLPHKELLETVQRLAVRHIFLPSSSDKKNVF FLLSTCEYSKLEEPNVDNVSVDSLISLEEQLETALSVSRARKAELMMEYIESLKEKEKLLREEN QVLASQDLEEKIQNYLPHKELLETVQRLAVRHIFLPSSSDKKNVFFLLSTCEYSKLEEPNVDNV SVDSLISLEEQLETALSVSRARKAELMMEYIESLKEKEKLLREENQVLASQDLEEKIQNYLPHK ELLETVQRLAVRHIFLPSSSDKKNVFFLLSTCEYSKLEEPNVDNVSVDSLISLEEQLETALSVS RARKAELMMEYIESLKEKEKLLREENQVLASQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |