Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G77080_circ_g.4 |
ID in PlantcircBase | ath_circ_010577 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 28958602-28959371 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | AT1G77080 |
Parent gene annotation |
K-box region and MADS-box transcription factor family protein |
Parent gene strand | + |
Alternative splicing | AT1G77080_circ_g.1 AT1G77080_circ_g.2 AT1G77080_circ_g.3 AT1G77080_circ_g.5 AT1G77080_circ_g.6 |
Support reads | 2 |
Tissues | root, inflorescences |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G77080.10:4 AT1G77080.6:3 AT1G77080.2:4 AT1G77080.8:3 AT1G77080.5:4 AT1G77080.3:2 AT1G77080.7:4 AT1G77080.12:4 AT1G77080.9:3 AT1G77080.4:4 AT1G77080.11:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.149162521 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28958962-28959368(+) |
Potential amino acid sequence |
MMEYIESLKEKEKLLREENQVLASQDLEEKIQNYLPHKELLETVQRLAVRHIFLPSSSDKKNVF FLLSTCEYSKLEEPNVDNVSVDSLISLEEQLETALSVSRARKAELMMEYIESLKEKEKLLREEN QVLASQDLEEKIQNYLPHKELLETVQRLAVRHIFLPSSSDKKNVFFLLSTCEYSKLEEPNVDNV SVDSLISLEEQLETALSVSRARKAELMMEYIESLKEKEKLLREENQVLASQDLEEKIQNYLPHK ELLETVQRLAVRHIFLPSSSDKKNVFFLLSTCEYSKLEEPNVDNVSVDSLISLEEQLETALSVS RARKAELMMEYIESLKEKEKLLREENQVLASQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |