Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0388400_circ_g.3 |
ID in PlantcircBase | osa_circ_027740 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 18782278-18783774 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
Parent gene | Os05g0388400 |
Parent gene annotation |
Similar to cDNA clone:J013089M16, full insert sequence. (Os05t03 88400-01) |
Parent gene strand | + |
Alternative splicing | Os05g0388400_circ_g.2 |
Support reads | 3 |
Tissues | shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0388400-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006213* osi_circ_015406 |
PMCS | 0.240299332 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18782777-18782738(+) 18783759-18782362(+) |
Potential amino acid sequence |
MLHGIVYFSFNIVVSLVLMSAVLRRWLKEHNNINIFVEPRVSKELVTEDSYFNFIQTWDNDEEM KTLHTKVDLIVTLGGDGTVLWAPFKLSWGCNGDNNGQHKHDFVSFEKGDITTAERSNKQILLKW ESPPQTVLFVTKPNSNSVHALCAEMVRYVFFLLCVPTWSGMSKVLYFINHLSSALKIASFLFLE LVLS*(+) MEQFYGHHLNFHGDAMGIIMVSTSMILYPSKKGI*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |