Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0811100_circ_g.1 |
| ID in PlantcircBase | osa_circ_004529 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 34471638-34472069 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0811100 |
| Parent gene annotation |
Proteasome subunit alpha type 3 (EC 3.4.25.1) (20S proteasome al pha subunit G) (20S proteasome subunit alpha-7). (Os01t0811100-0 1);Proteasome subunit alpha type 3 (EC 3.4.25.1) (20S proteasome alpha subunit G) (20S proteasome subunit alpha-7). (Os01t081110 0-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0811100-02:3 Os01t0811100-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.188657909 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34471665-34471640(+) 34471676-34472031(-) |
| Potential amino acid sequence |
MSSIGTGYDLSVTTFSPDGRVFQVEYATKAVDNSGTVVGIKCKDGIVLGVEKLVTSKMMLEGSN RRIHSVHWHSGLE*(+) MLLIFNYSVLSTPSQSASALNGSSY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |