Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0811100_circ_g.1 |
ID in PlantcircBase | osa_circ_004529 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 34471638-34472069 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0811100 |
Parent gene annotation |
Proteasome subunit alpha type 3 (EC 3.4.25.1) (20S proteasome al pha subunit G) (20S proteasome subunit alpha-7). (Os01t0811100-0 1);Proteasome subunit alpha type 3 (EC 3.4.25.1) (20S proteasome alpha subunit G) (20S proteasome subunit alpha-7). (Os01t081110 0-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0811100-02:3 Os01t0811100-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.188657909 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34471665-34471640(+) 34471676-34472031(-) |
Potential amino acid sequence |
MSSIGTGYDLSVTTFSPDGRVFQVEYATKAVDNSGTVVGIKCKDGIVLGVEKLVTSKMMLEGSN RRIHSVHWHSGLE*(+) MLLIFNYSVLSTPSQSASALNGSSY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |