Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G79280_circ_g.7 |
| ID in PlantcircBase | ath_circ_010959 |
| Alias | Ath_circ_FC1072 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 29822560-29822864 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT1G79280 |
| Parent gene annotation |
nuclear pore anchor |
| Parent gene strand | - |
| Alternative splicing | AT1G79280_circ_g.8 AT1G79280_circ_g.9 AT1G79280_circ_g.10 AT1G79280_circ_g.11 AT1G79280_circ_g.12 AT1G79280_circ_g.13 AT1G79280_circ_g.14 AT1G79280_circ_g.15 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G79280.2:2 AT1G79280.1:2 AT1G79280.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.105737705 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29822862-29822562(-) |
| Potential amino acid sequence |
MREVAQKARMESENFENLLKTKQTELDLCMKEMEKLRMETDLHKKRVDELRETYRNIDIADYNR LKDEVRQLEEMREVAQKARMESENFENLLKTKQTELDLCMKEMEKLRMETDLHKKRVDELRETY RNIDIADYNRLKDEVRQLEEMREVAQKARMESENFENLLKTKQTELDLCMKEMEKLRMETDLHK KRVDELRETYRNIDIADYNRLKDEVRQLEEMREVAQKARMESENFENLLKTKQTELDLCMKEME KLRMETDLHKKRVDELRETYRNIDIADYNRLKDEVRQLE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |