Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0919400_circ_g.1 |
| ID in PlantcircBase | osa_circ_005501 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 40102127-40102254 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os01g0919400 |
| Parent gene annotation |
Sucrose phosphate synthase, Sucrose synthesis in pollen germinat ion (Os01t0919400-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0919400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.282872727 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
40102194-40102127(+) 40102199-40102165(+) 40102238-40102253(-) 40102206-40102253(-) |
| Potential amino acid sequence |
MRWHRRPRILTLSRISSIVLT*(+) MASEATHPHPLPHLIDRPHLSACDLDARRGTT*(+) MRERVRMRGLRCHLMYCRNATRLQVVPLLASRSQALR*(-) MPSHVLQECNKASSCSSSSIEVTSTQVRTIDEMRERVRMRGLRCHLMYCRNATRLQVVPLLASR SQALR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |