Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G18890_circ_g.15 |
ID in PlantcircBase | ath_circ_022629 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 6514233-6514364 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT3G18890 |
Parent gene annotation |
Protein TIC 62, chloroplastic |
Parent gene strand | + |
Alternative splicing | AT3G18890_circ_g.16 AT3G18890_circ_g.17 AT3G18890_circ_g.18 AT3G18890_circ_g.19 AT3G18890_circ_g.20 |
Support reads | 9 |
Tissues | leaf, aerial, inflorescences, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G18890.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.199056944 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6514298-6514235(-) |
Potential amino acid sequence |
MLLPWDLLMQELVRLVVSGLRKDFHQLFSAHHYCLQVTLSCLLQMLLPWDLLMQELVRLVVSGL RKDFHQLFSAHHYCLQVTLSCLLQMLLPWDLLMQELVRLVVSGLRKDFHQLFSAHHYCLQVTLS CLLQMLLPWDLLMQELVRLVVSGLR(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |