Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G64790_circ_g.31 |
| ID in PlantcircBase | ath_circ_008715 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 24078258-24078335 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G64790 |
| Parent gene annotation |
Protein ILITYHIA |
| Parent gene strand | - |
| Alternative splicing | AT1G64790_circ_g.28 AT1G64790_circ_g.29 AT1G64790_circ_g.30 AT1G64790_circ_g.32 AT1G64790_circ_g.33 AT1G64790_circ_g.34 AT1G64790_circ_g.35 AT1G64790_circ_g.36 AT1G64790_circ_g.37 AT1G64790_circ_g.38 AT1G64790_circ_g.39 AT1G64790_circ_g.40 |
| Support reads | 1 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G64790.2:1 AT1G64790.1:1 AT1G64790.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.226494234 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24078302-24078260(-) |
| Potential amino acid sequence |
MLLLFCLPMGKVFARDCKSVSKLVVLMLLLFCLPMGKVFARDCKSVSKLVVLMLLLFCLPMGKV FARDCKSVSKLVVLMLLLFCLPMGKVFA(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |