Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0794500_circ_g.7 |
| ID in PlantcircBase | osa_circ_022251 |
| Alias | Os_ciR1181 |
| Organism | Oryza sativa |
| Position | chr3: 33040810-33040923 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0794500 |
| Parent gene annotation |
Similar to Glutamate dehydrogenase (EC 1.4.1.3) (GDH). (Os03t079 4500-01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0794500_circ_g.2 Os03g0794500_circ_g.3 Os03g0794500_circ_g.4 Os03g0794500_circ_g.5 Os03g0794500_circ_g.6 Os03g0794500_circ_g.8 Os03g0794500_circ_g.9 |
| Support reads | 14/4 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0794500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.476227558 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33040841-33040812(-) |
| Potential amino acid sequence |
MKGGIRYHHEVECTIPKDDGTLASYVGFRVQHDNARGPMKGGIRYHHEVECTIPKDDGTLASYV GFRVQHDNARGPMKGGIRYHHEVECTIPKDDGTLASYVGFRVQHDNARGPMKGGIRYHHE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |