Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0531500_circ_g.1 |
| ID in PlantcircBase | osa_circ_028625 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 26383514-26383713 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0531500 |
| Parent gene annotation |
Similar to cDNA, clone: J075118M20, full insert sequence. (Os05t 0531500-01);Similar to cDNA, clone: J075118M20, full insert sequ ence. (Os05t0531500-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0531500-01:1 Os05t0531500-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.68199 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26383667-26383645(+) |
| Potential amino acid sequence |
MPEMFLDCERRNFVIQMSLKVVSSSESTFPSRISSHAFGSMKLTVSPPGIKLVSAPSGTK*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |