Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G74560_circ_g.7 |
| ID in PlantcircBase | ath_circ_010177 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 28018138-28018530 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G74560 |
| Parent gene annotation |
NAP1-related protein 1 |
| Parent gene strand | - |
| Alternative splicing | AT1G74560_circ_g.1 AT1G74560_circ_g.2 AT1G74560_circ_g.3 AT1G74560_circ_g.4 AT1G74560_circ_g.5 AT1G74560_circ_g.6 AT1G74560_circ_g.8 |
| Support reads | 1 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G74560.3:3 AT1G74560.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.137013782 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28018293-28018527(+) |
| Potential amino acid sequence |
MNLIPSIFLMLSISKPSKETLLWQCTFISFLIIMVHSIWQAIVEVGERVGPEIFLDNISNLIMN LIPSIFLMLSISKPSKETLLWQCTFISFLIIMVHSIWQAIVEVGERVGPEIFLDNISNLIMNLI PSIFLMLSISKPSKETLLWQCTFISFLIIMVHSIWQAIVEVGERVGPEIFLDNISNLIMNLIPS IFLMLSISKPSKETLLWQCTFISFLIIMVHSIWQA(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |