Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0772600_circ_g.6 |
| ID in PlantcircBase | osa_circ_004108 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 32620786-32621552 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0772600 |
| Parent gene annotation |
Similar to Casein kinase-like protein. (Os01t0772600-01);Similar to Casein kinase-like protein. (Os01t0772600-02);Similar to ATP binding protein. (Os01t0772600-03) |
| Parent gene strand | + |
| Alternative splicing | Os01g0772600_circ_g.3 Os01g0772600_circ_g.4 Os01g0772600_circ_g.5 Os01g0772600_circ_g.7 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0772600-02:3 Os01t0772600-03:3 Os01t0772600-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.25344259 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32620899-32620839(+) 32620821-32621523(-) |
| Potential amino acid sequence |
MDAGTGFTSQVYELSPIFLHKDWIMEQWENNYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSE SFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGFSEQIPLQCSRCQTSSTHREGK*(+) MKSGICYIVMVSVQKIQNSLT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |