Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0556700_circ_g.14 |
| ID in PlantcircBase | osa_circ_007974 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 21894403-21894508 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0556700 |
| Parent gene annotation |
CCR4-Not1 complex component, mRNA deadenylation (Os10t0556700-01 ) |
| Parent gene strand | - |
| Alternative splicing | Os10g0556700_circ_g.7 Os10g0556700_circ_g.8 Os10g0556700_circ_g.9 Os10g0556700_circ_g.10 Os10g0556700_circ_g.11 Os10g0556700_circ_g.12 Os10g0556700_circ_g.13 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0556700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.350976101 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21894506-21894487(-) |
| Potential amino acid sequence |
MDMALDKAIKEIIGPVIQRSVTIASRTTKELILKNHGYGFG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |