Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.011G194200_circ_g.1 |
| ID in PlantcircBase | gra_circ_001239 |
| Alias | Chr11:46950366|46951306 |
| Organism | Gossypium raimondii |
| Position | chrChr11: 46950366-46951306 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.011G194200 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.011G194200.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.507863611 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
46950864-46950436(+) 46950391-46951265(-) 46950414-46951103(-) |
| Potential amino acid sequence |
MLRDVVITGDNGTIDGQGSVWWEWFTSHSLNYSCPHLVEFVSSESILVSNITFLNAPAYNMHPV YCSHVHIHHITVYAPPGSPYTVGIVPGGIAVAAGIVQCNQNSWRRKQWAV*(+) MPAATAMPPGTIPTVYGDPGGA*(-) MNFDCIAQCQQQQQCHLGLYQQYMVILVEHRPLCDECAHGCNRLDACYMQGR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |