Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d003644_circ_g.2 |
ID in PlantcircBase | zma_circ_007172 |
Alias | Zm02circ00048 |
Organism | Zea mays |
Position | chr2: 51540651-51541336 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d003644 |
Parent gene annotation |
Kinesin-like protein KIN-7C mitochondrial |
Parent gene strand | + |
Alternative splicing | Zm00001d003644_circ_g.3 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d003644_T008:3 Zm00001d003644_T012:3 Zm00001d003644_T002:3 Zm00001d003644_T018:1 Zm00001d003644_T005:3 Zm00001d003644_T017:2 Zm00001d003644_T003:3 Zm00001d003644_T011:3 Zm00001d003644_T014:3 Zm00001d003644_T004:3 Zm00001d003644_T006:3 Zm00001d003644_T013:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.08313207 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
51540663-51541079(-) |
Potential amino acid sequence |
MPVLVPRVSKLLFMYEPSLRRKPVVSVLELSDPARSIKFN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |