Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d003644_circ_g.2 |
| ID in PlantcircBase | zma_circ_007172 |
| Alias | Zm02circ00048 |
| Organism | Zea mays |
| Position | chr2: 51540651-51541336 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d003644 |
| Parent gene annotation |
Kinesin-like protein KIN-7C mitochondrial |
| Parent gene strand | + |
| Alternative splicing | Zm00001d003644_circ_g.3 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d003644_T008:3 Zm00001d003644_T012:3 Zm00001d003644_T002:3 Zm00001d003644_T018:1 Zm00001d003644_T005:3 Zm00001d003644_T017:2 Zm00001d003644_T003:3 Zm00001d003644_T011:3 Zm00001d003644_T014:3 Zm00001d003644_T004:3 Zm00001d003644_T006:3 Zm00001d003644_T013:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.08313207 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
51540663-51541079(-) |
| Potential amino acid sequence |
MPVLVPRVSKLLFMYEPSLRRKPVVSVLELSDPARSIKFN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020 |