Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0347900_circ_g.3 |
ID in PlantcircBase | osa_circ_019791 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 13038990-13039771 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0347900 |
Parent gene annotation |
Terpenoid synthase domain containing protein. (Os03t0347900-01); Terpenoid cylases/protein prenyltransferase alpha-alpha toroid d omain containing protein. (Os03t0347900-02) |
Parent gene strand | - |
Alternative splicing | Os03g0347900_circ_g.1 Os03g0347900_circ_g.2 Os03g0347900_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0347900-01:2 Os03t0347900-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_013006 |
PMCS | 0.238900139 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13039604-13039762(-) |
Potential amino acid sequence |
MHAILEEGQKLNEAIQRWDESAISVLPEYLKNYYAKLMSTFKEIEDELKSEEKYYITYAVKAVG K*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |