Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G45640_circ_g.1 |
| ID in PlantcircBase | ath_circ_018560 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 18800033-18800107 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT2G45640 |
| Parent gene annotation |
SAP18 |
| Parent gene strand | - |
| Alternative splicing | AT2G45640_circ_g.2 AT2G45640_circ_g.3 AT2G45640_circ_g.4 |
| Support reads | 1 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G45640.2:1 AT2G45640.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.105555556 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18800096-18800035(-) 18800068-18800035(-) |
| Potential amino acid sequence |
MAYPNRKQPDDSKTLSELPFEVGETMAYPNRKQPDDSKTLSELPFEVGETMAYPNRKQPDDSKT LSELPFEVGETMAYPNRKQPDDSKTLSELPFE(-) MTVKRFPNFRLRLGRRWLIQTENNQMTVKRFPNFRLRLGRRWLIQTENNQMTVKRFPNFRLRLG RRWLIQTENNQMTVKRFPNFRL(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |