Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G45640_circ_g.1 |
ID in PlantcircBase | ath_circ_018560 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 18800033-18800107 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G45640 |
Parent gene annotation |
SAP18 |
Parent gene strand | - |
Alternative splicing | AT2G45640_circ_g.2 AT2G45640_circ_g.3 AT2G45640_circ_g.4 |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G45640.2:1 AT2G45640.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.105555556 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18800096-18800035(-) 18800068-18800035(-) |
Potential amino acid sequence |
MAYPNRKQPDDSKTLSELPFEVGETMAYPNRKQPDDSKTLSELPFEVGETMAYPNRKQPDDSKT LSELPFEVGETMAYPNRKQPDDSKTLSELPFE(-) MTVKRFPNFRLRLGRRWLIQTENNQMTVKRFPNFRLRLGRRWLIQTENNQMTVKRFPNFRLRLG RRWLIQTENNQMTVKRFPNFRL(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |