Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0444400_circ_g.1 |
| ID in PlantcircBase | osa_circ_006924 |
| Alias | Os_ciR2789 |
| Organism | Oryza sativa |
| Position | chr10: 16018769-16020055 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os10g0444400 |
| Parent gene annotation |
Similar to Appr-1-p processing enzyme family protein. (Os10t0444 400-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0444400-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.197494788 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16019613-16019032(+) |
| Potential amino acid sequence |
MSLIKDPDLRRKEQWEKSAQAQKGFNYAKLLGYGDLACPSLSAAEEYSLHSRYLAKANSLNLSE IAEMKIIYRGGVDSEGRPVMVVVGAHFLLRCLDLERFVLHVVKELLDAFWRNKKAKLLVLFFVL YHHLIQRYTRDCSHYISLGTGKRKRLRYQNFQPMLGMRMVKQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |