Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0227700_circ_g.3 |
| ID in PlantcircBase | osa_circ_027084 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 7763720-7763813 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os05g0227700 |
| Parent gene annotation |
Similar to Eukaryotic translation initiation factor 3 subunit 6- interacting protein. (Os05t0227700-01);Similar to Eukaryotic tra nslation initiation factor 3 subunit 6-interacting protein. (Os0 5t0227700-02);Similar to Eukaryotic translation initiation facto r 3 subunit 6-interacting protein. (Os05t0227700-03) |
| Parent gene strand | - |
| Alternative splicing | Os05g0227700_circ_g.1 Os05g0227700_circ_g.2 Os05g0227700_circ_g.4 Os05g0227700_circ_g.5 Os05g0227700_circ_g.6 |
| Support reads | 6 |
| Tissues | seed, pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0227700-03:1 Os05t0227700-02:1 Os05t0227700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.446914894 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7763781-7763754(+) 7763755-7763776(+) 7763805-7763768(-) 7763726-7763768(-) |
| Potential amino acid sequence |
MHFVLVCHKNCPHQYRSQSLHWI*(+) MTFPSLSIECILCLYVIRIVLINIEVKVCTGYDLSVTVD*(+) MTYKHKMHSIDSDGKVISSADFDFYIDEDNSYDIQAQNAFNRQ*(-) MRTILMTYKHKMHSIDSDGKVISSADFDFYIDEDNSYDIQAQNAFNRQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |