Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc11g008700.1_circ_g.2 |
ID in PlantcircBase | sly_circ_003257 |
Alias | 11:2883263|2884418 |
Organism | Solanum lycopersicum |
Position | chr11: 2883263-2884418 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc11g008700.1 |
Parent gene annotation |
protein_coding |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 6 |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Solyc11g008700.1.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.361315525 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2884378-2883343(+) 2883293-2884360(-) 2883459-2884382(-) |
Potential amino acid sequence |
MLVYSPGGIQQSSALLFSSFFRLIFFSQFPLAIMCCCGSFN*(+) MSLKKLLKRRALLCWIPPGEYTSMVGRKE*(-) MTYAEEEELFPTLPADISSGNENKNMDNTEANKNAINSIETATATHNGKRKLTEKDEPEKAAEK KSTTLLDTSWRVH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | fruit ripening |
Other Information | |
---|---|
References | Yin et al., 2018 |