Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0658500_circ_g.2 |
| ID in PlantcircBase | osa_circ_003082 |
| Alias | Os_ciR5976 |
| Organism | Oryza sativa |
| Position | chr1: 26786519-26787363 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0658500 |
| Parent gene annotation |
ESCRT-II complex, vps25 subunit domain containing protein. (Os01 t0658500-01);Similar to Vacuolar protein sorting protein 25. (Os 01t0658500-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0658500-01:4 Os01t0658500-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.247336174 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26787249-26786540(+) 26786789-26787310(-) |
| Potential amino acid sequence |
MGNLLLGRLYIAFDFYNNQVSDLSTAALAFHVFLAQAAISPTCFNS*(+) MDKGHKKCLILWLRIQDWANYILNFVKDNGLEDSVMTVEEIRSGIETRGTDCSLCEKHVKSKCS CGKI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |