Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_16G067200_circ_g.1 |
| ID in PlantcircBase | gma_circ_007308 |
| Alias | gma-circRNA2290 |
| Organism | Glycine max |
| Position | chr16: 6658643-6659561 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_16G067200 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | KRH07086:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.042346717 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6659495-6658700(+) 6659446-6658651(+) 6658735-6658720(-) |
| Potential amino acid sequence |
MYLMTVVLETWIGQNVLTMLVASSAGEVPEGTFGESWVSRWR*(+) MESQDDVDQLLKHELIHVFDDCRAGNLDWTKCAHHACSELRR*(+) MLSHLTAFMKLSPTRHPAFSKCSLRNFTCGARYKHGEHILSNPSFQHDSHQIHELAHALTAGQH HLEIPSRCSTQLSLHPEYNHQLLQCCHT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | cytoplasmic male sterility |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |