Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0789150_circ_g.2 |
| ID in PlantcircBase | osa_circ_016863 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 33533074-33533360 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ie-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0789150 |
| Parent gene annotation |
Hypothetical protein. (Os02t0789150-00) |
| Parent gene strand | + |
| Alternative splicing | Os02g0789150_circ_g.1 |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0789100-01:1 Os02t0789100-01:1 Os02t0789150-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.22622018 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33533167-33533356(-) |
| Potential amino acid sequence |
MFQPALFNQAPGQRFLMKYFYSLWWGLQNLRY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |