Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0789150_circ_g.2 |
ID in PlantcircBase | osa_circ_016863 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 33533074-33533360 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ie-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0789150 |
Parent gene annotation |
Hypothetical protein. (Os02t0789150-00) |
Parent gene strand | + |
Alternative splicing | Os02g0789150_circ_g.1 |
Support reads | 4 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0789100-01:1 Os02t0789100-01:1 Os02t0789150-00:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.22622018 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
33533167-33533356(-) |
Potential amino acid sequence |
MFQPALFNQAPGQRFLMKYFYSLWWGLQNLRY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |