Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0266500_circ_g.1 |
| ID in PlantcircBase | osa_circ_014199 |
| Alias | Os_ciR8414 |
| Organism | Oryza sativa |
| Position | chr2: 9524373-9527368 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0266500 |
| Parent gene annotation |
tRNA(Ile)-lysidine/2-thiocytidine synthase domain containing pro tein. (Os02t0266500-01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0266500_circ_g.2 Os02g0266500_circ_g.3 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0266500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.105016789 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9527337-9524453(+) 9524433-9527292(-) |
| Potential amino acid sequence |
MVLKKSLTIMEVLFVRLLHVNGRMGDQSWGIFKKLPVK*(+) MPQLWSPIRPFTCSNLTNNTSIIVKDFFKTILQALSINARVNRHA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |