Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d045104_circ_g.2 |
ID in PlantcircBase | zma_circ_009847 |
Alias | zma_circ_0003068 |
Organism | Zea mays |
Position | chr9: 12693040-12694432 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d045104 |
Parent gene annotation |
Ubiquitin carboxyl-terminal hydrolase |
Parent gene strand | + |
Alternative splicing | Zm00001d045104_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d045104_T006:4 Zm00001d045104_T010:4 Zm00001d045104_T003:3 Zm00001d045104_T013:4 Zm00001d045104_T014:1 Zm00001d045104_T002:3 Zm00001d045104_T001:3 Zm00001d045104_T016:4 Zm00001d045104_T015:2 Zm00001d045104_T005:4 Zm00001d045104_T009:4 Zm00001d045104_T004:3 Zm00001d045104_T017:3 Zm00001d045104_T012:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.241923092 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12694423-12693650(+) 12693647-12693096(+) 12693065-12694369(-) |
Potential amino acid sequence |
MIKRSHIRILCIMCSSDTCQDCSRINWKNSDTISYCQELALHFSHFPKFKTRRCTRVNG*(+) MVNLLESMHKCCLPSGVSTESQSAYDKSLVHKIFGGRLRSQVKCTRCLHCSNKFDPFLDLSLEI AKATTLVRALENFTEDELLDEGQKEYECERCRQKVVAKKRLTIDKAPNVLTIHLKRFSPFNPRE KIDKKVDFQSILDLKPFVSDSKGTDFKYSLYGVLVHTGWSTQSGHYYCYVRTSSGMWHNLDDKE VAHPDFVHYVLFRYMSRLL*(+) MHKIRMCDLFIIKIVPHPAGCTNVAIVMA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |