Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0108000_circ_g.2 |
ID in PlantcircBase | osa_circ_000078 |
Alias | Os_ciR6479 |
Organism | Oryza sativa |
Position | chr1: 423524-423774 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os01g0108000 |
Parent gene annotation |
Conserved hypothetical protein. (Os01t0108000-01) |
Parent gene strand | + |
Alternative splicing | Os01g0108000_circ_g.3 Os01g0108000_circ_g.4 Os01g0108000_circ_g.5 Os01g0108000_circ_g.6 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0108000-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.244105246 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
423595-423526(+) 423547-423715(-) 423609-423768(-) |
Potential amino acid sequence |
MASNMSWKHDLTAKIKENEEEIAQLRKHLADYSLKA*(+) MLAFFSMPSMSSQQDVFLIAQSLPHFL*(-) MFEAISEAGNNPCPARFNLGSCSPSFLCLQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |