Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0813500_circ_g.1 |
| ID in PlantcircBase | osa_circ_004551 |
| Alias | Os_ciR5110 |
| Organism | Oryza sativa |
| Position | chr1: 34584685-34584820 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0813500 |
| Parent gene annotation |
EAP30 domain containing protein. (Os01t0813500-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0813500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.401740196 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34584746-34584773(+) 34584701-34584765(-) |
| Potential amino acid sequence |
MQHRWGLFPSEGHPPFVQVMRFSQIPMLSAFRRCSFAKAGAIPSVNAASLGLIPF*(+) MQKALVFARISSLAQKEDALQKGISPSDAAFTLGIAPALAKEHLLNAESIGICENLITCTKGGC PSEGNKPQRCCIYTWDCTCFSEGASSKCRKHWYLRESHHLHKRRMPFRRE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |