Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G20150_circ_g.4 |
ID in PlantcircBase | ath_circ_022906 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 7035143-7035417 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder |
Parent gene | AT3G20150 |
Parent gene annotation |
Kinesin-like protein KIN-12F |
Parent gene strand | + |
Alternative splicing | AT3G20150_circ_g.3 |
Support reads | 1 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G20150.1:2 AT3G20150.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.472166572 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7035155-7035414(+) |
Potential amino acid sequence |
MEGVLEKQQELEKLCSEQAAKIEQLTRLVGQHKLQTEDETEKLMGASNGERLPSANENQDGYHM EGVLEKQQELEKLCSEQAAKIEQLTRLVGQHKLQTEDETEKLMGASNGERLPSANENQDGYHME GVLEKQQELEKLCSEQAAKIEQLTRLVGQHKLQTEDETEKLMGASNGERLPSANENQDGYHMEG VLEKQQELEKLCSEQAAKIEQLTRLVGQHKLQTEDETEKLMGASNGERLPSANENQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |