Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0752300_circ_g.1 |
ID in PlantcircBase | osa_circ_016590 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 31625838-31625891 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os02g0752300 |
Parent gene annotation |
Conserved hypothetical protein. (Os02t0752300-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0752300-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.083333333 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
31625867-31625888(+) 31625885-31625840(-) |
Potential amino acid sequence |
MEIGPHECSSKPSPCVLIMEIGPHECSSKPSPCVLIMEIGPHECSSKPSPCVLIMEIGPHEC(+ ) MWTDLHYQDTRGRLAAAFMWTDLHYQDTRGRLAAAFMWTDLHYQDTRGRLAAAFMWTDLHYQDT RGRLA(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |