Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0290300_circ_g.1 |
ID in PlantcircBase | osa_circ_014310 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 10974672-10977692 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0290300 |
Parent gene annotation |
WD40/YVTN repeat-like domain containing protein. (Os02t0290300-0 1) |
Parent gene strand | - |
Alternative splicing | Os02g0290300_circ_g.2 Os02g0290300_circ_g.3 Os02g0290300_circ_g.4 Os02g0290300_circ_g.5 Os02g0290300_circ_g.6 Os02g0290300_circ_g.7 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0290300-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.094039945 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10975029-10974701(+) 10974717-10977637(-) |
Potential amino acid sequence |
MATNRSAFQRISLNLKHIFLDKAIQPCACDICTIVLQDPELSFLSPRHSSKLI*(+) MADSQMSLLECLGDRKESSGSCSTMVQISQAQG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |