Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0290300_circ_g.1 |
| ID in PlantcircBase | osa_circ_014310 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 10974672-10977692 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0290300 |
| Parent gene annotation |
WD40/YVTN repeat-like domain containing protein. (Os02t0290300-0 1) |
| Parent gene strand | - |
| Alternative splicing | Os02g0290300_circ_g.2 Os02g0290300_circ_g.3 Os02g0290300_circ_g.4 Os02g0290300_circ_g.5 Os02g0290300_circ_g.6 Os02g0290300_circ_g.7 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0290300-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.094039945 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10975029-10974701(+) 10974717-10977637(-) |
| Potential amino acid sequence |
MATNRSAFQRISLNLKHIFLDKAIQPCACDICTIVLQDPELSFLSPRHSSKLI*(+) MADSQMSLLECLGDRKESSGSCSTMVQISQAQG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |