Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G13690_circ_g.6 |
| ID in PlantcircBase | ath_circ_021531 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 4489146-4489456 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G13690 |
| Parent gene annotation |
Kinase with adenine nucleotide alpha hydrolases-like domain-cont aining protein |
| Parent gene strand | + |
| Alternative splicing | AT3G13690_circ_g.4 AT3G13690_circ_g.5 AT3G13690_circ_g.7 |
| Support reads | 1 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G13690.2:2 AT3G13690.3:2 AT3G13690.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.359892271 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4489188-4489453(+) |
| Potential amino acid sequence |
MGVDTRVIGTFGYLAPEYAQSGQITEKADVYSFGVVLVELVTGRKAIDITRPKGQQCLTEWVGD FGLARWQPDGEMGVDTRVIGTFGYLAPEYAQSGQITEKADVYSFGVVLVELVTGRKAIDITRPK GQQCLTEWVGDFGLARWQPDGEMGVDTRVIGTFGYLAPEYAQSGQITEKADVYSFGVVLVELVT GRKAIDITRPKGQQCLTEWVGDFGLARWQPDGEMGVDTRVIGTFGYLAPEYAQSGQITEKADVY SFGVVLVELVTGRKAIDITRPKGQQCLTEW(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |