Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0589100_circ_g.1 |
| ID in PlantcircBase | osa_circ_012135 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 24637885-24638974 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0589100 |
| Parent gene annotation |
Similar to Adenine phosphoribosyltransferase. (Os12t0589100-01) |
| Parent gene strand | - |
| Alternative splicing | Os12g0589100_circ_g.2 Os12g0589100_circ_g.3 Os12g0589100_circ_g.4 Os12g0589100_circ_g.5 Os12g0589100_circ_g.6 Os12g0589100_circ_g.7 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0589100-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.137359618 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24638971-24638872(-) |
| Potential amino acid sequence |
MFQDITTMLLKPDAFRDTIELFVERYKDKGITVIAGVEARGFIFGPPIALALGAKFVPLRKPKK LPGEVISEEYSLEYGTDKIEMHVGAVEPNGRAVVVDDLIATGGTLSAAVKLIERAGAEVVECAC VIELPELKGLCFKISQQCFSSQMHFVTRSSSSLSDTRTKGSL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |