Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0605400_circ_g.1 |
ID in PlantcircBase | osa_circ_015390 |
Alias | Os_ciR4655 |
Organism | Oryza sativa |
Position | chr2: 23722440-23723645 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0605400 |
Parent gene annotation |
C2 calcium-dependent membrane targeting domain containing protei n. (Os02t0605400-00) |
Parent gene strand | + |
Alternative splicing | Os02g0605400_circ_g.2 |
Support reads | 4/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0605400-00:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.227730922 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23723617-23722589(+) 23723030-23722516(+) |
Potential amino acid sequence |
MEHPLHAVKMVTITMYDWDTVCKCKVIGSVTVAVLGEDEAGATWFDLDSKSGQVKCKIDE*(+) MMIHVSYAETFHLSLVLPDCSPKLFLCSGEVFPAPWAYVHLLMASVLPLQCILQTVEYSRHPHH FIPQIKRSQHSLINPAITIFLRTGSGGHGTPPSCSQNGNHNNVRLGHSVQVQSYWICNCSRSR* (+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |