Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d008429_circ_g.1 |
ID in PlantcircBase | zma_circ_009539 |
Alias | zma_circ_0003011 |
Organism | Zea mays |
Position | chr8: 8455598-8457066 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d008429 |
Parent gene annotation |
Paired amphipathic helix protein Sin3-like 3 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d008429_T020:6 Zm00001d008429_T032:6 Zm00001d008429_T036:5 Zm00001d008429_T034:6 Zm00001d008429_T033:6 Zm00001d008429_T008:6 Zm00001d008429_T014:6 Zm00001d008429_T002:6 Zm00001d008429_T027:6 Zm00001d008429_T022:6 Zm00001d008429_T001:5 Zm00001d008429_T017:6 Zm00001d008429_T038:6 Zm00001d008429_T004:6 Zm00001d008429_T026:6 Zm00001d008429_T029:6 Zm00001d008429_T030:6 Zm00001d008429_T023:6 Zm00001d008429_T025:6 Zm00001d008429_T010:6 Zm00001d008429_T007:6 Zm00001d008429_T015:6 Zm00001d008429_T006:6 Zm00001d008429_T021:6 Zm00001d008429_T018:5 Zm00001d008429_T040:1 Zm00001d008429_T019:6 Zm00001d008429_T013:5 Zm00001d008429_T012:6 Zm00001d008429_T003:6 Zm00001d008429_T028:6 Zm00001d008429_T035:6 Zm00001d008429_T024:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.189745711 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8455602-8455621(-) |
Potential amino acid sequence |
MILYERLLSAKTNSFTAEKKWRNSKDTNPPDLYAKFMSALYNLLDGSSDNTKFEDDCRAIIGTQ SYVLFTLDKLIYKVVKQLQAIATDEMDNKLLQLYLYEKSRSPGRFFDLVYHENARVLLHDESIY RFECCSSPTRLSIQLMEYGHEKPEVTAVSIDPNFSSYLFGEYLCSTSDKKLSEGVYLARNKRKY SDNDEPSDFLKAMDGIKVVNGLECKISCKTSKVSYVLDTEDFLSRLRKRRKILRGGSVSDSSQF SKIYAAKVQRFNRFLSKA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |