Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Cotton_A_20477_circ_g.1 |
ID in PlantcircBase | gar_circ_000027 |
Alias | CA_chr1_BGI-A2_v1.0:59100505|59100752 |
Organism | Gossypium arboreum |
Position | chrCA_chr1_BGI-A2_v1.0: 59100505-59100752 JBrowse» |
Reference genome | BGI-A2_v1.0 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Cotton_A_20477 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2/4 |
Tissues | leaf/ovule |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Cotton_A_20477:2 |
Conservation Information | |
---|---|
Conserved circRNAs | ghi_circ_000061 |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
59100694-59100504(+) |
Potential amino acid sequence |
MQLRILAFQLLLLLMLEEHSDRSLLREWEDCGQPKIVVSCRNQQEMNKLRDAAEDIGLPTFVVA DAGRTQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Zhao et al., 2017b |