Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0788800_circ_g.1 |
ID in PlantcircBase | osa_circ_016859 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 33513480-33514592 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0788800 |
Parent gene annotation |
Amino acid transporter, transmembrane domain containing protein. (Os02t0788800-01);Similar to amino acid transporter family prot ein. (Os02t0788800-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0788800-01:4 Os02t0788800-02:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.221067962 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
33514590-33513959(+) 33514134-33514557(-) |
Potential amino acid sequence |
MTKNGIRNAMHTVDATRAVLSIIEQIVSFKNPSGRNSSKLRANGFNNRAYLVKGLITVVHSATL EANECLGRFRVICERVLSPNMR*(+) MSDRTKFTKALFICFAICTAIYGSFAIIGYLMFGDKTLSQITLNLPKHSFASKVALWTTVINPF TKYALLLNPLARSLEELRPEGFLNETICSIILRTALVASTVCIAFLMPFFVILCGIHYFGRR*( -) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |