Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0657200_circ_g.9 |
| ID in PlantcircBase | osa_circ_035086 |
| Alias | Os_ciR11159 |
| Organism | Oryza sativa |
| Position | chr7: 27661680-27661865 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os07g0657200 |
| Parent gene annotation |
WD40/YVTN repeat-like domain containing protein. (Os07t0657200-0 1);WD40/YVTN repeat-like domain containing protein. (Os07t065720 0-02);Similar to Sec31p. (Os07t0657200-03);Similar to Sec31p. (O s07t0657200-04) |
| Parent gene strand | + |
| Alternative splicing | Os07g0657200_circ_g.8 Os07g0657200_circ_g.10 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0657200-04:1 Os07t0657200-02:1 Os07t0657200-03:1 Os07t0657200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.454141353 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27661835-27661752(+) 27661727-27661728(-) |
| Potential amino acid sequence |
MVGRLMLIFSSLPGKRNGMFYAIPLHLDCWELEIH*(+) MQGYRIEHSIPLSWQTGEDQHKSSHHLQTSSRETIFPQLCRYFQHKYNRESQLVYLQLPTV*(- ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |