Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0568200_circ_g.5 |
| ID in PlantcircBase | osa_circ_031206 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 21964783-21965605 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0568200 |
| Parent gene annotation |
Vacuolar ATPase B subunit. (Os06t0568200-01);Similar to Vacuolar ATPase B subunit. (Os06t0568200-02) |
| Parent gene strand | - |
| Alternative splicing | Os06g0568200_circ_g.4 Os06g0568200_circ_g.6 Os06g0568200_circ_g.7 Os06g0568200_circ_g.8 Os06g0568200_circ_g.9 Os06g0568200_circ_g.10 Os06g0568200_circ_g.11 Os06g0568200_circ_g.12 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0568101-00:2 Os06t0568101-00:2 Os06t0568200-01:2 Os06t0568200-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.223291748 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21964804-21964798(+) 21965499-21965600(-) 21964790-21965600(-) |
| Potential amino acid sequence |
MGIWVMEPDLPSIRPARSYMVARSVYIYPGYPRLPGTSSRAADTSRSASAYELISVKMTSTCFP HSYAKYSAVVSAIRGVMIRSMVGSFAIIRHC*(+) MSSYADALREVSAAREEVPGRRGYPGYMYTDLATIYERAGRIEGRSGSITQIPILTMPNDGK*( -) MMANDPTIERIITPRIALTTAEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRGYPG YMYTDLATIYERAGRIEGRSGSITQIPILTMPNDGK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |