Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0147900_circ_g.3 |
| ID in PlantcircBase | osa_circ_000305 |
| Alias | Os01circ02357/Os_ciR2342 |
| Organism | Oryza sativa |
| Position | chr1: 2590622-2592163 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
| Parent gene | Os01g0147900 |
| Parent gene annotation |
Triosephosphate isomerase, cytosolic (EC 5.3.1.1) (TIM) (Triose- phosphate isomerase). (Os01t0147900-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0147900_circ_g.1 Os01g0147900_circ_g.2 Os01g0147900_circ_g.4 Os01g0147900_circ_g.5 Os01g0147900_circ_g.6 Os01g0147900_circ_g.7 Os01g0147900_circ_g.8 Os01g0147900_circ_g.9 Os01g0147900_circ_g.10 Os01g0147900_circ_g.11 Os01g0147900_circ_g.12 |
| Support reads | 2/4/3 |
| Tissues | leaf and panicle/root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0147900-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_001800* osi_circ_010494 |
| PMCS | 0.355883058 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2591232-2592048(-) 2591680-2592073(-) |
| Potential amino acid sequence |
MLLLHKQKQFLKGSRIGLMWLLPMNLCGPLELVKLLHQIKHKKGGCQPTLCVPSRGQESAAPGD PSCCSELLGEEGRGFHR*(-) MLVNLSIPWVILGHSERRSLLGESNEFVGDKVAYALSQGLKVIACVGETLEQRESGSTMDVVAA QTKAISERIKDWTNVVVAYEPVWAIGTGKVATPDQAQERWLSAHLMCSFPWSRVSCARRSKLLL RIVG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |