Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0218400_circ_g.4 |
ID in PlantcircBase | osa_circ_027013 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 7281211-7281902 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0218400 |
Parent gene annotation |
Similar to Somatic embryogenesis receptor kinase-like protein. ( Os05t0218400-01) |
Parent gene strand | - |
Alternative splicing | Os05g0218400_circ_g.2 Os05g0218400_circ_g.3 Os05g0218400_circ_g.5 Os05g0218400_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0218400-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.170684959 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7281887-7281823(-) |
Potential amino acid sequence |
MEWPTRLKIALGAAKGLAYLHEDCHPKIIHRDIKASNILLDFKFESKVADFGLAKFTSDNNTHV STRVMGTFGKRPTNNGVAHKTKDCFGSCKGFSLSS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |