Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G52080_circ_g.1 |
ID in PlantcircBase | ath_circ_006922 |
Alias | AT1G52080_C1, AT1G52080_C1 |
Organism | Arabidpsis thaliana |
Position | chr1: 19369704-19370079 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | CIRI2 |
Parent gene | AT1G52080 |
Parent gene annotation |
Actin binding protein family |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G52080.2:2 AT1G52080.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.116808511 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19369789-19369730(+) 19370046-19369782(+) |
Potential amino acid sequence |
MIITTHKRDINLLVLQLGAALAVSFAGFLFARFRKNTKRIGPTLPPLPPHSSDNGYRDYSNKSI DMEVDEEEEI* MDTETIPTNPLIWRSMKKKRYDLVVLQIENLGVVVFYW* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |