Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0543600_circ_g.1 |
ID in PlantcircBase | osa_circ_037914 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 27211547-27212034 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0543600 |
Parent gene annotation |
Alpha-isopropylmalate/homocitrate synthase, conserved site domai n containing protein. (Os08t0543600-01);Hypothetical conserved g ene. (Os08t0543600-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0543600-02:1 Os08t0543600-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018127 |
PMCS | 0.191258163 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27212010-27211613(+) 27211835-27212027(-) 27211681-27212023(-) |
Potential amino acid sequence |
MKSPSITKSFPVASHHNHAWYYLQEGQIVPV*(+) MPSRNGSTTASFGDQFDKGGHIPKPNDSVGYNIVQGIGDVTIASKVKDIQENGFSDEVRPGQSS MHAVSANGVRQERSGLPAGNTRHGYGGKQQGSSL*(-) MAFQMKFDLGSHPCMLFLQMESDRNDLAFLQVIPGMVMVGSNREALCD*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |