Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d050551_circ_g.2 |
ID in PlantcircBase | zma_circ_008078 |
Alias | Zm04circ00047, GRMZM2G028766_C1 |
Organism | Zea mays |
Position | chr4: 99653627-99654384 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d050551 |
Parent gene annotation |
ubiquitin-associated (UBA)/TS-N domain-containing protein |
Parent gene strand | + |
Alternative splicing | Zm00001d050551_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d050551_T002:3 Zm00001d050551_T004:4 Zm00001d050551_T011:3 Zm00001d050551_T013:2 Zm00001d050551_T008:4 Zm00001d050551_T007:4 Zm00001d050551_T003:4 Zm00001d050551_T010:4 Zm00001d050551_T012:2 Zm00001d050551_T001:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.081422988 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
99654347-99654132(+) 99653803-99654141(-) |
Potential amino acid sequence |
MRDCLRNLKQQNKERIRIGKELLEAKRIEEQNERKRMIELRKLEKEEEKRAREKIRQKLEEDKA ERRRKLGLPPEDPAAAKPSAPLPVEEKKAFSFESGFSFTMMAIAIL*(+) MRFLSFCSSILLASRSSFPIRILSLFCCLRFLRQSLILSAFVAGLGSIALNNFHLSGPIGQDLK NRTK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |