Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d050551_circ_g.2 |
| ID in PlantcircBase | zma_circ_008078 |
| Alias | Zm04circ00047, GRMZM2G028766_C1 |
| Organism | Zea mays |
| Position | chr4: 99653627-99654384 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d050551 |
| Parent gene annotation |
ubiquitin-associated (UBA)/TS-N domain-containing protein |
| Parent gene strand | + |
| Alternative splicing | Zm00001d050551_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d050551_T002:3 Zm00001d050551_T004:4 Zm00001d050551_T011:3 Zm00001d050551_T013:2 Zm00001d050551_T008:4 Zm00001d050551_T007:4 Zm00001d050551_T003:4 Zm00001d050551_T010:4 Zm00001d050551_T012:2 Zm00001d050551_T001:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.081422988 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
99654347-99654132(+) 99653803-99654141(-) |
| Potential amino acid sequence |
MRDCLRNLKQQNKERIRIGKELLEAKRIEEQNERKRMIELRKLEKEEEKRAREKIRQKLEEDKA ERRRKLGLPPEDPAAAKPSAPLPVEEKKAFSFESGFSFTMMAIAIL*(+) MRFLSFCSSILLASRSSFPIRILSLFCCLRFLRQSLILSAFVAGLGSIALNNFHLSGPIGQDLK NRTK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |