Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0103300_circ_g.2 |
| ID in PlantcircBase | osa_circ_022877 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 227481-227591 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0103300 |
| Parent gene annotation |
Protein of unknown function DUF1751, integral membrane, eukaryot ic domain containing protein. (Os04t0103300-01);Protein of unkno wn function DUF1751, integral membrane, eukaryotic domain contai ning protein. (Os04t0103300-02);Protein of unknown function DUF1 751, integral membrane, eukaryotic domain containing protein. (O s04t0103300-03) |
| Parent gene strand | - |
| Alternative splicing | Os04g0103300_circ_g.3 Os04g0103300_circ_g.4 Os04g0103300_circ_g.5 Os04g0103300_circ_g.6 Os04g0103300_circ_g.7 Os04g0103300_circ_g.8 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0103300-01:1 Os04t0103300-03:1 Os04t0103300-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.083333333 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
227556-227483(-) |
| Potential amino acid sequence |
MLCARSRPSELALPVSDPAKASRRRPVTDPVANLFDRMLCARSRPSELALPVSDPAKASRRRPV TDPVANLFDRMLCARSRPSELALPVSDPAKASRRRPVTDPVANLFDRMLCARSRPSELALPVSD PAKASRR(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |