Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa7G451960_circ_g.1 |
| ID in PlantcircBase | csa_circ_004790 |
| Alias | Chr7:18866773_18867977 |
| Organism | Cucumis sativus |
| Position | chrChr7: 18866773-18867977 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | e-circRNA |
| Identification method | CIRI2;Find_circ |
| Parent gene | Csa7G451960 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf,root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Csa7G451960.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 1.025582248 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18867153-18866804(+) |
| Potential amino acid sequence |
MSDDVSNSEHACPKKSNSEDTCPKKSNSEVSSDSAPEISHSDIPLEETNHASSSKVLSEHRRRT PNDSEDDGTEGVKRMRGLEDLGMGSLANGKSHAGVQLEKVQQEDASHCDANTGNCVTNGNGNPP KIIHMYSSSLRRKRSPVATVQEFLKRKNRRRPLTKVLESTAMVSVPVFCDQLPNTCSSNLWGSS DGKISELDTESKRTNSLAVINSSDGNGTAVSCDDEAFLSASEVSRINSKAKENEVSSISEISEN KTSDKLFDVTLVKEEKHPAVTGTILRNLRG* |
| Sponge-miRNAs | csa-miRn6-3p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhu et al., 2019;He et al., 2020 |