Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0219300_circ_g.3 |
| ID in PlantcircBase | osa_circ_018555 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 6277988-6278845 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0219300 |
| Parent gene annotation |
Similar to Tubulin alpha-2 chain (Alpha-2 tubulin). (Os03t021930 0-01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0219300_circ_g.4 Os03g0219300_circ_g.5 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0219300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.318466715 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6278682-6277993(+) 6278815-6278033(+) |
| Potential amino acid sequence |
MSCSGWKSWRYGPVFTSSITVGSRSTNNALGTCLPELVSLKNVLNASLAIPGVVSLW*(+) MHPLQFQELCRCGEGYIVNPSFDFLP*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |